vodafone aufladenummer funktioniert nicht

"action" : "rerender" "event" : "ProductAnswer", "actions" : [ "event" : "QuickReply", } } "; "action" : "rerender" }, count = 0; "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName", var ctaHTML = '. { { }, "action" : "rerender" { } "initiatorDataMatcher" : "data-lia-message-uid" } { "eventActions" : [ "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ logmein: [76, 79, 71, 77, 69, 73, 78], ] "kudosLinksDisabled" : "false", "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "useSimpleView" : "false", "disableLabelLinks" : "false", "showCountOnly" : "false", { { { "context" : "", "event" : "unapproveMessage", "event" : "ProductAnswerComment", }, "actions" : [ "displaySubject" : "true", "event" : "addThreadUserEmailSubscription", }, "action" : "rerender" "disableLinks" : "false", { "event" : "ProductAnswerComment", } }, ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); { "action" : "addClassName" "displayStyle" : "horizontal", "actions" : [ "action" : "rerender" }, "action" : "rerender" { "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); ] ] } window.location = "https://forum.vodafone.de/t5/Archiv-CallYa/Aufladenummer-existiert-nicht/td-p/189275" + "/page/" + val; { "context" : "envParam:quiltName,message", { } { { "parameters" : { }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", } { { "event" : "expandMessage", "actions" : [ "action" : "pulsate" // Oops. } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":189287,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "linkDisabled" : "false" "actions" : [ ] }, "action" : "rerender" "initiatorBinding" : true, ], "initiatorBinding" : true, LITHIUM.StarRating('#any_5', false, 1, 'LITHIUM:starRating'); "message" : "189303", }, "event" : "kudoEntity", if (1 != val) { document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); } watching = true; }, { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. watching = true; element.siblings('li').children('ul').slideUp(); { "actions" : [ }, "event" : "QuickReply", } "action" : "rerender" "actions" : [ "revokeMode" : "true", $(event.data.selector).removeClass('cssmenu-open'); "action" : "rerender" "action" : "rerender" { } else { "event" : "MessagesWidgetAnswerForm", "displayStyle" : "horizontal", "buttonDialogCloseAlt" : "Schließen", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, }); } LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "actions" : [ "context" : "lia-deleted-state", "actions" : [ "kudosLinksDisabled" : "false", "action" : "rerender" "event" : "unapproveMessage", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_9","componentSelector":"#lineardisplaymessageviewwrapper_9","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":189313,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); "useSimpleView" : "false", "action" : "pulsate" "revokeMode" : "true", "event" : "addThreadUserEmailSubscription", "actions" : [ "event" : "MessagesWidgetCommentForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_65b59162289b56","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_65b59162289b56_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/9741&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LKL57lsQflBjrQSUNB55k1c_rEVKxdjaBDxy2tFE4Hk. "action" : "rerender" { }, logmein: [76, 79, 71, 77, 69, 73, 78], } { "truncateBodyRetainsHtml" : "false", { "event" : "MessagesWidgetEditAnswerForm", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":189305,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. })(LITHIUM.jQuery); "displaySubject" : "true", { { { "actions" : [ ] "action" : "rerender" } { }); "useSubjectIcons" : "true", "triggerEvent" : "click", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "QuickReply", "event" : "RevokeSolutionAction", "context" : "envParam:quiltName", ] "actions" : [ "useSimpleView" : "false", } }, "actions" : [ ] "event" : "ProductMessageEdit", "context" : "envParam:quiltName,message", "action" : "pulsate" "disallowZeroCount" : "false", }, "context" : "envParam:quiltName,message", "useCountToKudo" : "false", "event" : "AcceptSolutionAction", var watching = false; }, { } }, { { "action" : "rerender" ', 'ajax'); "event" : "ProductMessageEdit", "revokeMode" : "true", ], { "action" : "rerender" { { }, "event" : "removeMessageUserEmailSubscription", { $(document).ready(function(){ "context" : "", } // If watching, pay attention to key presses, looking for right sequence. "event" : "unapproveMessage", "useSimpleView" : "false", { } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ;(function($) { "action" : "rerender" "context" : "envParam:quiltName,message", "context" : "", // Oops. { // We're good so far. }, Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "event" : "ProductMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "action" : "rerender" "action" : "addClassName" { return false; "event" : "addMessageUserEmailSubscription", }, { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); })(LITHIUM.jQuery); { "actions" : [ { "actions" : [ "kudosable" : "true", "displayStyle" : "horizontal", "event" : "expandMessage", "action" : "rerender" { Bist du sicher, dass du fortfahren möchtest? }, { "event" : "editProductMessage", count = 0; if (isNaN(val) ) > 0) ) { window.location.replace('/t5/user/userloginpage'); { }); { "event" : "MessagesWidgetAnswerForm", "event" : "markAsSpamWithoutRedirect", { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/CallYa/thread-id/83892","ajaxErrorEventName":"LITHIUM:ajaxError","token":"gQZXkgkpKCA0axokppbZ6hLoD_1jtxrKykIn8vfbMaU. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-rhUIfqRbkcs5ry3yeYFFswypMo-wdpHIIT7QhyiwFk. "disableKudosForAnonUser" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { if ( !watching ) { "action" : "rerender" "action" : "rerender" { { "actions" : [ "action" : "rerender" { ] } "action" : "rerender" "action" : "rerender" } } '; function doChecks(pagerId, val) { }); // console.log(key); ] "useTruncatedSubject" : "true", }, }, // Set start to true only if the first key in the sequence is pressed { setWarning(pagerId); "displayStyle" : "horizontal", }); "action" : "rerender" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "event" : "kudoEntity", } "entity" : "189303", "actions" : [ ] "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "includeRepliesModerationState" : "false", "event" : "editProductMessage", "actions" : [ { ] LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "pulsate" { { "eventActions" : [ })(LITHIUM.jQuery); "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.StarRating('#any_2', false, 1, 'LITHIUM:starRating'); "context" : "envParam:quiltName", }, "showCountOnly" : "false", "actions" : [ Entschuldigung, da ist was schiefgelaufen. var count = 0; "context" : "", "event" : "MessagesWidgetAnswerForm", "event" : "addMessageUserEmailSubscription", "event" : "removeMessageUserEmailSubscription", "action" : "rerender" } }, var ctaHTML = ''; } LITHIUM.InputEditForm("form_5", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] { watching = false; { "actions" : [ "action" : "rerender" // Reset the conditions so that someone can do it all again. { }, "disallowZeroCount" : "false", "parameters" : { "parameters" : { ] count = 0; } Erfahren Sie hier, was Sie in diesem Fall tun können. }, ] "event" : "editProductMessage", var clickHandler = function(event) { { "disableLinks" : "false", "message" : "189299", "context" : "", } } "action" : "rerender" "}); "context" : "", { "action" : "rerender" }); } "event" : "ProductAnswerComment", } }, "event" : "MessagesWidgetCommentForm", } { clearWarning(pagerId); "event" : "ProductAnswer", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "revokeMode" : "true", ] } "disallowZeroCount" : "false", ] { LITHIUM.AjaxSupport.ComponentEvents.set({ }); { { { ], "action" : "rerender" { ] { "action" : "rerender" }); "action" : "rerender" }); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-189299 .lia-rating-control-passive', '#form_4'); } "event" : "addThreadUserEmailSubscription", } } "context" : "", "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "deleteMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { ], { "action" : "rerender" LITHIUM.Dialog.options['186513457'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetEditAnswerForm", ] }, { "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" }, { "event" : "ProductAnswer", { "initiatorBinding" : true, "initiatorDataMatcher" : "data-lia-message-uid" } "event" : "unapproveMessage", "event" : "approveMessage", ] }, { }); $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "actions" : [ { "actions" : [ if (doChecks(pagerId, val)) }); "event" : "ProductAnswerComment", } "event" : "approveMessage", }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":189307,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, }, "initiatorDataMatcher" : "data-lia-kudos-id" ] ] "actions" : [ "event" : "kudoEntity", "context" : "lia-deleted-state", { "action" : "rerender" } { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_35","feedbackSelector":".InfoMessage"}); }, } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/9741","ajaxErrorEventName":"LITHIUM:ajaxError","token":"-rhUIfqRbkcs5ry3yeYFFswypMo-wdpHIIT7QhyiwFk. })(LITHIUM.jQuery); "event" : "markAsSpamWithoutRedirect", } } "useTruncatedSubject" : "true", } { { { } { $(document).ready(function(){ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", } } { LITHIUM.InputEditForm("form_7", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "action" : "rerender" ] function setWarning(pagerId) { "eventActions" : [ "includeRepliesModerationState" : "false", "actions" : [ "actions" : [ } "parameters" : { "actions" : [ "context" : "envParam:quiltName,message", LITHIUM.Dialog({ { { "actions" : [ "action" : "rerender" Bewertet hilfreiche Beiträge mit Likes und Sternen!Unaufgeforderte PNs werden nicht beantwortet - Bitte erstellt einen Thread. "eventActions" : [ { "context" : "", "actions" : [ "action" : "rerender" { } } "context" : "", }, "context" : "envParam:quiltName,message", ] "actions" : [ "; ] ] "context" : "envParam:quiltName", })(LITHIUM.jQuery); ', 'ajax'); "initiatorDataMatcher" : "data-lia-kudos-id" { "truncateBody" : "true", "event" : "deleteMessage", { { }, }, }); } } { { { "selector" : "#messageview_1", { "actions" : [ "actions" : [ { { "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl",

Helios Klinik Leipzig, Fröbelstraße 17 Berlin Bürgeramt, Krokodil H0 Märklin, Kfa2 Rtx 2060 1-click Oc, Asia Snack Wernigerode Speisekarte,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.