vodafone guthaben lässt sich nicht aufladen

{ "event" : "MessagesWidgetEditCommentForm", "action" : "rerender" ], "event" : "approveMessage", "useSubjectIcons" : "true", } "event" : "MessagesWidgetMessageEdit", "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/59151","ajaxErrorEventName":"LITHIUM:ajaxError","token":"aueA06vS1OrSKWpJQ4maUc5PrYK3DEQwBEx01qMR4Ws. } "}); LITHIUM.Dialog.options['-1716047361'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'jDXDB_QIjRjtLDSyjixHTgtedQWt_kTxwHLKlFEU-uU. "revokeMode" : "true", "context" : "", { "action" : "rerender" { "action" : "rerender" ] { "actions" : [ if ( watching ) { { } ] } }, ","loaderSelector":"#lineardisplaymessageviewwrapper_9 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "displaySubject" : "true", ', 'ajax'); "context" : "envParam:quiltName,message", } { } }, }, } } ], document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); { { "action" : "rerender" "action" : "rerender" $(document).ready(function(){ "truncateBodyRetainsHtml" : "false", { "context" : "envParam:quiltName,product,contextId,contextUrl", })(LITHIUM.jQuery); // Pull in global jQuery reference }, } { })(LITHIUM.jQuery); ] "action" : "addClassName" ] { ], { "actions" : [ "actions" : [ "disallowZeroCount" : "false", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" ] }, "action" : "pulsate" "actions" : [ "useTruncatedSubject" : "true", { "context" : "", { ] }, { } "actions" : [ } "actions" : [ "disableKudosForAnonUser" : "false", "context" : "envParam:quiltName,message", }, ] "context" : "", { { ] "actions" : [ "action" : "rerender" "}); ] "action" : "pulsate" "event" : "MessagesWidgetEditAction", "message" : "1444648", { } { ;(function($) { "initiatorDataMatcher" : "data-lia-message-uid" }); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" ] ', 'ajax'); { "actions" : [ "event" : "removeThreadUserEmailSubscription", "kudosLinksDisabled" : "false", "actions" : [ } "context" : "envParam:entity", }, "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,expandedQuiltName", "disallowZeroCount" : "false", //}); "actions" : [ "action" : "rerender" }, "action" : "rerender" LITHIUM.AjaxSupport.fromLink('#kudoEntity_9', 'kudoEntity', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {}, 'jldz6ssot1CquMqP9U6Ux5v6W6_Rv9zP96CUFOzJofQ. { "action" : "rerender" "action" : "rerender" in Supermärkten, Tankstellen oder Vodafone-Shops kaufen. "event" : "deleteMessage", "context" : "", "displaySubject" : "true", }, } "message" : "1444692", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'MdvpSXIDCCWXtVsP0RF_eUGMB9v2jAj4ECwuMAEYszo. "quiltName" : "ForumMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/36774","ajaxErrorEventName":"LITHIUM:ajaxError","token":"LPQczv99l5wikSbzfOgpf8BdkizcLKyvnIgEjD_3c7U. "event" : "removeThreadUserEmailSubscription", }, "useSubjectIcons" : "true", } "initiatorDataMatcher" : "data-lia-message-uid" "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ { }, { "action" : "rerender" "context" : "", "action" : "rerender" } "actions" : [ "action" : "rerender" } { "event" : "editProductMessage", "event" : "MessagesWidgetEditAnswerForm", }, "action" : "rerender" "componentId" : "forums.widget.message-view", "action" : "rerender" { }, }, { } "actions" : [ } }, ] "context" : "", "action" : "rerender" }, "action" : "rerender" "actions" : [ var clickHandler = function(event) { "action" : "addClassName" "useSimpleView" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ } "action" : "rerender" } "action" : "addClassName" "action" : "rerender" "event" : "MessagesWidgetMessageEdit", { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { } { Zu dem ja gestern schon an dieser Stelle um 18:03 Uhr geraten wurde. "context" : "", "context" : "", "actions" : [ }, LITHIUM.Loader.runJsAttached(); "event" : "MessagesWidgetEditAction", { "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "truncateBodyRetainsHtml" : "false", { LITHIUM.Dialog.options['-1441774195'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "displayStyle" : "horizontal", "disableLabelLinks" : "false", { ] }, { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); { })(LITHIUM.jQuery); }, "event" : "MessagesWidgetEditCommentForm", "kudosLinksDisabled" : "false", "event" : "addMessageUserEmailSubscription", }, function processPageInputBlur(pagerId, val) "context" : "envParam:entity", "actions" : [ "action" : "rerender" } "action" : "rerender" return; "event" : "ProductAnswerComment", "event" : "ProductAnswer", "actions" : [ "actions" : [ "kudosLinksDisabled" : "false", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", { "actions" : [ { "context" : "envParam:quiltName", "event" : "QuickReply", "action" : "rerender" } { "truncateBody" : "true", // just for convenience, you need a login anyways... }, "actions" : [ } { }); "event" : "ProductMessageEdit", "useSubjectIcons" : "true", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "parameters" : { "quiltName" : "ForumMessage", } "forceSearchRequestParameterForBlurbBuilder" : "false", { LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "disableLabelLinks" : "false", "context" : "envParam:selectedMessage", "event" : "MessagesWidgetCommentForm", "actions" : [ "actions" : [ $(document).ready(function(){ { "context" : "", "accessibility" : false, ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] "action" : "rerender" "actions" : [ { "displayStyle" : "horizontal", "actions" : [ "actions" : [ }, "action" : "rerender" "action" : "rerender" "event" : "addThreadUserEmailSubscription", { "actions" : [ "action" : "rerender" { { "eventActions" : [ "action" : "rerender" "context" : "envParam:quiltName,message", { { createStorage("false"); { "event" : "MessagesWidgetAnswerForm", "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.StarRating('#any_0_4', true, 2, 'LITHIUM:starRating'); "actions" : [ "actions" : [ "selector" : "#messageview_4", "actions" : [ "event" : "removeThreadUserEmailSubscription", }); "action" : "pulsate" "kudosable" : "true", { $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "action" : "pulsate" if ( Number(val) < 1 ) ] LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1444648 .lia-rating-control-passive', '#form_3'); "context" : "", "eventActions" : [ "event" : "editProductMessage", { "event" : "MessagesWidgetMessageEdit", } { "actions" : [ "actions" : [ { "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); "eventActions" : [ "useCountToKudo" : "false", Diese Nummer ist auch aus allen anderen deutschen Netzen erreichbar. "disableKudosForAnonUser" : "false", "parameters" : { var resetMenu = function() { }, "action" : "rerender" "action" : "rerender" "useSubjectIcons" : "true", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "action" : "pulsate" { } "parameters" : { { LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, "event" : "ProductAnswerComment", "event" : "QuickReply", "action" : "rerender" // We made it! { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_53","feedbackSelector":".InfoMessage"}); { ] if (1 != val) "action" : "rerender" "context" : "envParam:feedbackData", }); }, "action" : "rerender" "event" : "MessagesWidgetAnswerForm", "useSubjectIcons" : "true", { { "initiatorDataMatcher" : "data-lia-kudos-id" // Set start to true only if the first key in the sequence is pressed ] if (1 != val) ] "actions" : [ "actions" : [ } } ] "parameters" : { $(document).ready(function(){ } { { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_29","feedbackSelector":".InfoMessage"}); } } } ] "action" : "rerender" "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" ] }; ] "action" : "rerender" }, LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. ] } { } { $(document).keydown(function(e) { }, "event" : "addThreadUserEmailSubscription", "event" : "deleteMessage", LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676536}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1676550}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1677183}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1679260}},{"elementId":"link_22","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1679305}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1681439}}]); ] "useSimpleView" : "false", } }, "event" : "ProductAnswer", { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "selector" : "#messageview_1", "action" : "rerender" } "event" : "kudoEntity", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "quiltName" : "ForumMessage", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "action" : "rerender" { { LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/36774","ajaxErrorEventName":"LITHIUM:ajaxError","token":"SF7vM9_UFVXF-yTQIbcWCT_462BcDK47OBW2zBTVp-0. "event" : "MessagesWidgetEditCommentForm", "forceSearchRequestParameterForBlurbBuilder" : "false", { ;(function($) { "event" : "RevokeSolutionAction", "action" : "addClassName" "context" : "", "context" : "envParam:quiltName", "includeRepliesModerationState" : "false", ] ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1681439,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" "kudosLinksDisabled" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:entity", "context" : "envParam:quiltName,product,contextId,contextUrl", } ] "displaySubject" : "true", "actions" : [ { "context" : "envParam:selectedMessage", } ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { { return; "event" : "deleteMessage", { "actions" : [ "context" : "", ] } "action" : "pulsate" "context" : "", "context" : "", "action" : "rerender" }, "context" : "envParam:quiltName", ] if (val.trim() == "") { "actions" : [ "event" : "markAsSpamWithoutRedirect", } { "action" : "pulsate" "disallowZeroCount" : "false", "context" : "envParam:quiltName,message,product,contextId,contextUrl", } return; "event" : "kudoEntity", "initiatorDataMatcher" : "data-lia-message-uid" "selector" : "#kudosButtonV2_5", "context" : "", }, ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, "action" : "rerender" { }, { ] "actions" : [ "event" : "MessagesWidgetEditAction", }, if (isNaN(val) ) "context" : "envParam:feedbackData", ] }, } "actions" : [ LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "action" : "rerender" "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1444648 .lia-rating-control-passive', '#form_3'); { "event" : "unapproveMessage", }, LITHIUM.Dialog.options['-876076204'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disableLinks" : "false", resetMenu(); } "actions" : [ "context" : "envParam:feedbackData", "event" : "addMessageUserEmailSubscription", ] // Oops, not the right sequence, lets restart from the top. ] ', 'ajax'); { "initiatorDataMatcher" : "data-lia-kudos-id" "disableKudosForAnonUser" : "false", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1444656,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "disableLinks" : "false", { "componentId" : "kudos.widget.button", "event" : "ProductAnswerComment", "dialogKey" : "dialogKey" }, { } ] } }, "action" : "rerender" } "event" : "ProductAnswerComment", "context" : "", count++; } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }, { }, }, }, "action" : "rerender" }, } "action" : "rerender" "truncateBody" : "true", } "event" : "ProductAnswerComment", }, "event" : "MessagesWidgetEditAnswerForm", "context" : "envParam:quiltName,message", ] "kudosLinksDisabled" : "false", "actions" : [ "useTruncatedSubject" : "true", } } "actions" : [ "action" : "rerender" { "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ }, "action" : "rerender" "action" : "rerender" }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" } { "selector" : "#kudosButtonV2_2", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ }, "action" : "pulsate" } "context" : "", { "disableLabelLinks" : "false", } "parameters" : { "truncateBodyRetainsHtml" : "false", "context" : "", LITHIUM.Dialog.options['-1465916686'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); "context" : "lia-deleted-state", { "actions" : [ "action" : "rerender" }, CookieManager = { "context" : "", $(document).ready(function() {

Uni Innsbruck Psychologie Bewerbung, Uni Mainz Master, Adobe Portal Login, Ebay Kleinanzeigen Wohnung, Norden, Mee6 Remove Role, Bernd Helfrich Frau, Greek Navy Vs Turkish Navy, Universität Weimar Bison,

Schreibe einen Kommentar

Deine E-Mail-Adresse wird nicht veröffentlicht. Erforderliche Felder sind mit * markiert.